Summary report for "wheat.usu.edu" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Title: Utah State Small Grains Research

Description:

Description:

Advertising budget: N/A

This site in Alpha Directory: w wh whe


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 4.48 $0.22*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. wheat bushel weight $0.06  9    1. wheat bushel weight 9    1. wheat bushel weight   9   
2. wheat pounds per bushel $0.05  10    2. wheat pounds per bushel 10    2. weight of bushel of wheat   10   
3. wheat bushel $0.04  13    3. wheat bushel 13    3. wheat pounds per bushel   10   
4. weight of bushel of wheat $0.03  10    4. weight of bushel of wheat 10    4. wheat weight per bushel   11   
5. bushel of wheat weight $0.02  11    5. bushel of wheat weight 11    5. bushel of wheat weight   11   
6. wheat weight per bushel $0.01  11    6. wheat weight per bushel 11    6. wheat bushel   13   
7. pounds in a bushel of wheat $0.00  18    7. pounds in a bushel of wheat 18    7. pounds in a bushel of wheat   18   

Competitors for "wheat.usu.edu"

Answers.ask.com: Ask Answers - Answers.Ask.com

You asked so we answered. Here is our answer to your most pressing questions delivered by our team of experts. Give it a try.

Keywords: washington dc; about blank; answers com; answers.com; who blocked me on msn;

Paid traffic cost: $1.74K

Faq.aces.uiuc.edu: ACES Frequently Asked Questions System

Keywords: swine management; soil permeability; soy protein amino acids; soy complete protein; soy protein complete;

Paid traffic cost: N/A

Wheat.state.ok.us:

Keywords: wheat; oklahoma commission; bushel of wheat; wheat bushel; oklahoma recipes;

Paid traffic cost: N/A

Spectrumcommodities.com: Spectrum Commodities - Commodity Brokers - Futures And Options and ...

Commodity futures market full-service and discount brokerage with online trading, quotes and charts, wheat, corn, soybeans, cattle, financial, energy and softs futures markets

Keywords: bushels; inside day; technical analysis of the futures markets; about cache; rough rice;

Paid traffic cost: N/A

Answers.yahoo.com: Yahoo! Answers - Home

Yahoo! Answers is a new way to find and share information. You can ask questions on any topic, get answers from real people, and share your insights and experience.

Keywords: o2; horse loan; yahoo answers; all categories; cheap;

Paid traffic cost: N/A

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; youtube; insurance; you tube; google;

Paid traffic cost: $0.3

Ilga.gov: Illinois General Assembly Home Page

Home page for the Illinois General Assembly

Keywords: illinois law; illinois condo; structured settlement protection act; il; illinois laws;

Paid traffic cost: N/A

Extension.missouri.edu: University of Missouri Extension Home

University of Missouri Extension, part of the national land-grant university and cooperative extension system, extending research-based knowledge and information from the campuses of the University of Missouri to all our citizens.

Keywords: mildew removal; mildew; extension; compost bins; armadillo;

Paid traffic cost: N/A

Waterquality.montana.edu: MSU Extension Water Quality Program

Household Water Use · Irrigation Management Monitoring Projects · Well Educated ... Prepared by Dr. Jim Bauder, MSU Extension Soil and Water Quality ...

Keywords: creosote; railroad ties; cbm; soil bioremediation; coal bed methane;

Paid traffic cost: N/A

Unc.edu: Home | The University of North Carolina at Chapel Hill

Keywords: unc; university of north carolina; units; renault; carolina;

Paid traffic cost: $13.01K

Extension.iastate.edu: Iowa State University Extension

ISU Extension provides reliable resources to encourage Healthy People, Healthy Environments, and Healthy Economies.

Keywords: iowa state university; piramide alimenticia; microsoft picture manager; picture manager; vegetable garden;

Paid traffic cost: N/A

Grainscanada.gc.ca: Welcome to the Canadian Grain Commission web site | Bienvenue au site de la Commission canadienne des grains

Keywords: ochratoxin; ochratoxin a; carthame; canadian grain commission; grain exports;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

generalspringkc.com

generalsridge.com

generalsridgevineyard.com

generalssports.com

generalssurplus.com

Recently processed sites:

kellerwilliamsgranbury.com

kellerwilliamsgr.com

kellerwilliamsgreast.yourkwoffice.com

kellerwilliamsgreenvilleandupstate.yourkwoffice.com

kellerwilliamsgreenvillecentral.yourkwoffice.com


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: