Summary report for "southtampa.wtsp.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Advertising budget: N/A

This site in Alpha Directory: s so sou


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 148.46 $9*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

Top cost equivalent positions (view all 30)   Top traffic positions (view all 30)   Top positions (view all 30)  
  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. bodyshapers fitness $2.43  5    1. bodyshapers fitness 49  5    1. traffic pacing   1   
2. traffic pacing $1.92  1    2. traffic pacing 38  1    2. south tampa news   4   
3. diving with manatees $1.27  13    3. tampa clerk of court 12  10    3. lululemon sportswear   4   
4. tampa clerk of court $0.58  10    4. sweetwater organic farm 11  9    4. bodyshapers fitness   5   
5. sweetwater organic farm $0.55  9    5. sun coast gun show 8    5. tampa bay rowdies stadium   7   
6. sun coast gun show $0.39  8    6. south tampa news 4    6. yoga south tampa   7   
7. dive with manatees $0.34  13    7. lululemon sportswear 4    7. publix south tampa   8   
8. south tampa news $0.27  4    8. tampa bay rowdies stadium 7    8. sun coast gun show   8   
9. lululemon sportswear $0.17  4    9. publix south tampa 8    9. sweetwater organic farm   9   
10. tampa bay rowdies stadium $0.15  7    10. 93.3 tampa bay 10    10. ralphie may norkeling   9   

Competitors for "southtampa.wtsp.com"

Britomart.org: Welcome to Britomart | Shopping, entertainment and business precinct | Auckland CBD

Keywords: westpac nz; coucou; britomart; joe malone; 1885;

Paid traffic cost: N/A

Manateetours.net: Manatee Tours Florida | AirTank Divers | Manatee Swims Swimming with ...

Manatee tours in Florida for swims with the Manatee in the ... Manatee Tours are snorkeling only (not scuba diving) You don't need to be a certified diver. ...

Keywords: manatee tours homosassa; manatee tours; manatee tours fl; manatee swims; manatee tour;

Paid traffic cost: $187.81

Fun2dive.com: Manatee Tours Scuba Charters Lessons Orlando|Crystal River

Manatee Tours Scuba Training Scuba Charters in the Orlando Crystal River area. Small groups, Full day, all-inclusive a great Florida adventure.

Keywords: rebreather training; sanford travel; manatee tours; swimming with manatees in florida; manatee diving;

Paid traffic cost: $1.91K

Southtampa.patch.com:

Keywords: samba room; south tampa; rose radiology; hyde park tampa; life style family fitness;

Paid traffic cost: N/A

Tampaymca.org: Tampa Metropolitan Area YMCA, Health, Wellness, Summer Camp, Swim Lessons, Fitness

Building Strong Kids, Strong Families and Strong Communities.

Keywords: tampa; ymca tampa; ymca.org; tampa area; floridakidcare org;

Paid traffic cost: $0.95

Bodyshapersfitness.com: Bodybuilding Supplements and Bodybuilding Nutrition Sports Supplements, Protein Supplements, Maximuscle | Bodyshapers Fitness

Bodybuilding supplements and sports supplements. Buy bodybuilding nutrition sports supplements at discounted prices including Maximuscle and Reflex Nutrition bodybuilding sports supplements.

Keywords: usn pure protein; maximuscle cyclone; usn supplements; bodybuilding supplements uk; sports supplement;

Paid traffic cost: N/A

Manateetoursusa.com: Crystal River Manatee Tours Snorkeling Diving Manatees Crystal River ...

Enjoy a Manatee Tour in Crystal River Florida today. ... Since manatees prefer the absence of scuba bubbles, snorkeling is the way for " ...

Keywords: crystal river manatees; crystal river manatee; manatee tours crystal river; crystal river manatee tour; manatee tour;

Paid traffic cost: N/A

Gunshowtrader.com:

Keywords: gun shows; gun show; suncoast gun show; gunshow; las vegas gun show;

Paid traffic cost: N/A

Localharvest.org: Local Harvest / Farmers Markets / Family Farms / CSA / Organic Food

Find locally grown produce anywhere in the country! Use our map to locate farmers markets, family farms, CSAs, farm stands, and u-pick produce in your neighborhood.

Keywords: produce market; csa; orange shop; fresh fruit; farms;

Paid traffic cost: $472.75

Greenpascocounty.org:

Keywords: pasco county sinkholes; sweetwater organic farm; pasco county landfill; sweetwater organic; sinkholes in pasco county;

Paid traffic cost: N/A

Tampabayrowdies.com: Tampa Bay Rowdies

Tampa Bay Rowdies,NASL,Soccer,Tampa Bay Sports,Tampa Stadium,Mike Connell,Tampa,Marsh,Connell,Wegerle,Rowdies

Keywords: tampa bay rowdies; rowdies; tampa bay soccer; tampa bay rowdies stadium;

Paid traffic cost: N/A

Examiner.com: Dallas News, Dallas Information, Dallas Events - Examiner.com | Examiner.com

Get the latest Dallas news and articles on topics that interest you - from our team of local insiders.

Keywords: gogle maps; shakira; dogs; x factor; grocery;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

pennsylvaniamastercrafttires.com

pennsylvania.maxfilings.com

pennsylvania.media.psu.edu

pennsylvaniamedicaidapplications.com

pennsylvaniamedicalassistant.jobs

Recently processed sites:

leshoppesalons.com

leshoppingdemarion.com

leshoppingdezoe.com

leshoppingexperience.com

leshop.se


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: