Summary report for "php.dzone.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Title: PHP Zone | Community for PHP users and developers

Description: db40 for .NET Cheat Sheet. This Refcard walks you through db4o's basic operations, various query types and data access optimization techniques.

Description: db40 for .NET Cheat Sheet. This Refcard walks you through db4o's basic operations, various query types and data access optimization techniques.

Advertising budget: N/A

This site in Alpha Directory: p ph php


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 575.17 $192.46*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

Top cost equivalent positions (view all 34)   Top traffic positions (view all 34)   Top positions (view all 34)  
  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. php performance $79.49  3    1. php performance 74  3    1. upload.php flash   1   
2. extract php $35.24  6    2. php flash upload 59  1    2. php flash upload   1   
3. code comments $24.49  6    3. php curl post 54  9    3. best php ajax framework   2   
4. performance php $15.36  3    4. extract php 52  6    4. best php mvc   2   
5. php cache $6.13  19    5. code comments 19  6    5. best php mvc framework   2   
6. sql injection php $3.92  15    6. wamp phpmyadmin 19  5    6. top 10 php frameworks   3   
7. php community $3.78  13    7. best php mvc framework 17  2    7. top php framework   3   
8. php flash upload $2.96  1    8. code comment 17  9    8. php performance   3   
9. php curl post $2.68  9    9. performance php 14  3    9. performance php   3   
10. subversion netbeans $2.61  11    10. ternary operator 14  16    10. netbeans subversion tutorial   3   

Competitors for "php.dzone.com"

Ontosys.com:

Keywords: php cache; php templates; templates php; php html template; php html templates;

Paid traffic cost: N/A

Phpbench.com: The PHP Benchmark

Keywords: php benchmark; php performance; performance php; php is empty; the php;

Paid traffic cost: N/A

Askapache.com: AskApache - Crazy Advanced Web Development

Crazy Advanced Web Development for server admins, WordPress bloggers, programmers, and hackers with topics and tools for Htaccess Rewrites, Linux and bash, PHP networking with cURL, SEO

Keywords: batch script; mac address lookup; htaccess; batch scripting; php ini;

Paid traffic cost: N/A

Solitarygeek.com: SolitaryGeek

James Selvakumar's Blog

Keywords: rapidsvn; rapid svn; subversion netbeans; subversion client; subversion clients;

Paid traffic cost: N/A

Javarevisited.blogspot.com:

Keywords: java synchronized; noclassdeffounderror; garbage collection; polymorphism; java heap;

Paid traffic cost: N/A

Github.com: Secure source code hosting and collaborative development - GitHub

Keywords: gmail; volo; sbt; cancan; imdb;

Paid traffic cost: $4.41

Plupload.com: Plupload - A tool for uploading files using Flash, Silverlight, Google Gears, HTML5 or Browserplus

Multiple file upload utility using Flash, Silverlight, Google Gears, HTML5 or BrowserPlus!

Keywords: application octet stream; upload tool; flash upload; uploading files; uploading tool;

Paid traffic cost: N/A

Developers.google.com:

Keywords: 1; blogger; picasa; charts; android;

Paid traffic cost: $12.26K

Farinspace.com: Practical Real World Web Development

A collection of practical real world web development tutorials. Learn to develop engaging, functional and efficient frontend/backend solutions using open source web tools and standards. Start using WordPress, jQuery, CodeIgniter, HTML, CSS, PHP/MySQL, AJAX and more.

Keywords: metabox; linux firewall.server; login linux; linux firewall server; secure ssh;

Paid traffic cost: N/A

Ledgersmbdev.blogspot.com:

Keywords: object relational database; object relational databases; intelligent database; code comments; code commenting;

Paid traffic cost: N/A

Shiflett.org: Chris Shiflett: PHP and Web Application Security

PHP and Web Application Security

Keywords: shared hosting; chris; chris shiflett; shared host; domain registrar;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

tampaflcontractor.com

tampaflcriminaldefenselawyers.com

tampafldebtattorney.com

tampafldomesticbatterylawyers.com

tampafldruglawyers.com

Recently processed sites:

grapestomptri.org

grapestone.co.jp

grapestoneconcepts.com

grapestone.worddetector.com

grapestowine.net


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: