
Summary report for "php.dzone.com" (monthly stats)
Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors
Title: PHP Zone | Community for PHP users and developers
Description: db40 for .NET Cheat Sheet. This Refcard walks you through db4o's basic operations, various query types and data access optimization techniques.
Description: db40 for .NET Cheat Sheet. This Refcard walks you through db4o's basic operations, various query types and data access optimization techniques.
Advertising budget: N/A
This site in Alpha Directory: p ph php
Approximate SE paid and organic traffic
Traffic | Est. Cost | |
---|---|---|
Organic keywords | 575.17 | $192.46* |
Paid keywords | N/A | N/A |
Try our new SERPTrends addon
SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.
Learn more about SERP Trends addon »


Organic keywords
Top cost equivalent positions (view all 34) | Top traffic positions (view all 34) | Top positions (view all 34) | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keyword | Cost Equiv. | Position | Keyword | Traffic | Position | Keyword | Position | |||||||
1. | php performance | $79.49 | 3 | 1. | php performance | 74 | 3 | 1. | upload.php flash | 1 | ||||
2. | extract php | $35.24 | 6 | 2. | php flash upload | 59 | 1 | 2. | php flash upload | 1 | ||||
3. | code comments | $24.49 | 6 | 3. | php curl post | 54 | 9 | 3. | best php ajax framework | 2 | ||||
4. | performance php | $15.36 | 3 | 4. | extract php | 52 | 6 | 4. | best php mvc | 2 | ||||
5. | php cache | $6.13 | 19 | 5. | code comments | 19 | 6 | 5. | best php mvc framework | 2 | ||||
6. | sql injection php | $3.92 | 15 | 6. | wamp phpmyadmin | 19 | 5 | 6. | top 10 php frameworks | 3 | ||||
7. | php community | $3.78 | 13 | 7. | best php mvc framework | 17 | 2 | 7. | top php framework | 3 | ||||
8. | php flash upload | $2.96 | 1 | 8. | code comment | 17 | 9 | 8. | php performance | 3 | ||||
9. | php curl post | $2.68 | 9 | 9. | performance php | 14 | 3 | 9. | performance php | 3 | ||||
10. | subversion netbeans | $2.61 | 11 | 10. | ternary operator | 14 | 16 | 10. | netbeans subversion tutorial | 3 |
Competitors for "php.dzone.com"
Ontosys.com:Keywords: php cache; php templates; templates php; php html template; php html templates; Paid traffic cost: N/A |
Phpbench.com: The PHP BenchmarkKeywords: php benchmark; php performance; performance php; php is empty; the php; Paid traffic cost: N/A |
Askapache.com: AskApache - Crazy Advanced Web DevelopmentCrazy Advanced Web Development for server admins, WordPress bloggers, programmers, and hackers with topics and tools for Htaccess Rewrites, Linux and bash, PHP networking with cURL, SEO Keywords: batch script; mac address lookup; htaccess; batch scripting; php ini; Paid traffic cost: N/A |
Solitarygeek.com: SolitaryGeekJames Selvakumar's Blog Keywords: rapidsvn; rapid svn; subversion netbeans; subversion client; subversion clients; Paid traffic cost: N/A |
Javarevisited.blogspot.com:Keywords: java synchronized; noclassdeffounderror; garbage collection; polymorphism; java heap; Paid traffic cost: N/A |
Github.com: Secure source code hosting and collaborative development - GitHubKeywords: gmail; volo; sbt; cancan; imdb; Paid traffic cost: $4.41 |
Plupload.com: Plupload - A tool for uploading files using Flash, Silverlight, Google Gears, HTML5 or BrowserplusMultiple file upload utility using Flash, Silverlight, Google Gears, HTML5 or BrowserPlus! Keywords: application octet stream; upload tool; flash upload; uploading files; uploading tool; Paid traffic cost: N/A |
Developers.google.com:Keywords: 1; blogger; picasa; charts; android; Paid traffic cost: $12.26K |
Farinspace.com: Practical Real World Web DevelopmentA collection of practical real world web development tutorials. Learn to develop engaging, functional and efficient frontend/backend solutions using open source web tools and standards. Start using WordPress, jQuery, CodeIgniter, HTML, CSS, PHP/MySQL, AJAX and more. Keywords: metabox; linux firewall.server; login linux; linux firewall server; secure ssh; Paid traffic cost: N/A |
Ledgersmbdev.blogspot.com:Keywords: object relational database; object relational databases; intelligent database; code comments; code commenting; Paid traffic cost: N/A |
Shiflett.org: Chris Shiflett: PHP and Web Application SecurityPHP and Web Application Security Keywords: shared hosting; chris; chris shiflett; shared host; domain registrar; Paid traffic cost: N/A |
Other top sites:
blackfridaydvdplayers.cheapprice47.com
blackfriday-dvi-lighting-bathroom.on2012deals.info
blackfridaydysondc25uss.blogspot.com