Summary report for "php-tutorial-php.blogspot.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Advertising budget: N/A

This site in Alpha Directory: p ph php


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 5.52 $0.28*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. php fsockopen tutorial $0.11  8    1. php fsockopen tutorial 8    1. php fsockopen tutorial   8   
2. fsockopen tutorial $0.11  10    2. fsockopen tutorial 10    2. fsockopen tutorial   10   
3. php soundex $0.06  12    3. php soundex 12    3. php soundex   12   

Competitors for "php-tutorial-php.blogspot.com"

Developers.chrisranjana.com: | Web developers notes,programming tutorials.

Keywords: asp substring; substring asp; asp substring function; smarty truncate; asp substr;

Paid traffic cost: N/A

Phptutorial.info: PHP tutorial for beginners

PHP tutorial for beginners

Keywords: php tutorial for beginners; fsockopen tutorial; php fsockopen tutorial; oci connect; simple php mailing list;

Paid traffic cost: N/A

W3cyberlearnings.com:

Keywords: php chop; php sqrt; php fputs; php popen; php stat;

Paid traffic cost: N/A

Forums.devshed.com: Dev Shed Forums - Open Source web development

Dev Shed Forums - over 275,577 members on our Dev Shed forums.

Keywords: general merchandise retail; pc cillin; pc-cillin; php forum; cfm;

Paid traffic cost: N/A

Stackoverflow.com: Stack Overflow

Keywords: orkut login; php; 0; localhost; gogole;

Paid traffic cost: N/A

Functions-online.com: execute PHP online - functions-online

Test functions of the language PHP. You find functions in the categories array, cryptography, custom, date and time, general, math, regular expression, string and url.

Keywords: strpos; str_replace; mktime; urldecode; online php;

Paid traffic cost: N/A

W3schools.com: W3Schools Online Web Tutorials

HTML XHTML CSS JavaScript XML XSL ASP SQL ADO VBScript Tutorials References Examples

Keywords: doctype; table; ol; background; html;

Paid traffic cost: N/A

Forum.sa-mp.com: SA-MP Forums - Powered by vBulletin

Multiplayer gaming discussion surrounding GTA: San Andreas

Keywords: sscanf; server advertising; fs download; server.exe; host my server;

Paid traffic cost: N/A

Kb.siteground.com: Web Hosting Knowledge Base by SiteGround

The largest web hosting knowledge base. Answers on website down, email, FTP, Domain name, website tranfer, FrontPage, cPanel, Fantastico, billing, SiteBuilder, eCommerce, SSL, PHP and MySQL scripts problems and more.

Keywords: smtp port; free smtp server; port 21; ftp port; web ftp;

Paid traffic cost: N/A

W3resource.com:

Keywords: _server; sql count; sql union; sql group by; php date;

Paid traffic cost: N/A

Tutorialhero.com: Free tutorials - Photoshop tutorials - Flash tutorials

Keywords: catia tutorial; microstation tutorial; architectural desktop tutorial; vectorworks tutorial; turbocad tutorial;

Paid traffic cost: N/A

Lists.mysql.com: MySQL Lists

Keywords: 40101; genteirc; myodbc; error code 126; select name;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

bangkokgarden.ca

bangkokgarden.com

bangkokgardencuisine.com

bangkokgarden-nj.com

bangkokgardenresort.com

Recently processed sites:

pennymcdole.com

pennymchenryhydrangeafestival.com

pennymcintire.com

pennymckinney.com.whoisbucket.com

penny-mclean.com


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: