
Summary report for "php-tutorial-php.blogspot.com" (monthly stats)
Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors
Advertising budget: N/A
This site in Alpha Directory: p ph php
Approximate SE paid and organic traffic
Traffic | Est. Cost | |
---|---|---|
Organic keywords | 5.52 | $0.28* |
Paid keywords | N/A | N/A |
Try our new SERPTrends addon
SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.
Learn more about SERP Trends addon »


Organic keywords
Keyword | Cost Equiv. | Position | Keyword | Traffic | Position | Keyword | Position | |||||||
1. | php fsockopen tutorial | $0.11 | 8 | 1. | php fsockopen tutorial | 2 | 8 | 1. | php fsockopen tutorial | 8 | ||||
2. | fsockopen tutorial | $0.11 | 10 | 2. | fsockopen tutorial | 2 | 10 | 2. | fsockopen tutorial | 10 | ||||
3. | php soundex | $0.06 | 12 | 3. | php soundex | 1 | 12 | 3. | php soundex | 12 |
Competitors for "php-tutorial-php.blogspot.com"
Developers.chrisranjana.com: | Web developers notes,programming tutorials.Keywords: asp substring; substring asp; asp substring function; smarty truncate; asp substr; Paid traffic cost: N/A |
Phptutorial.info: PHP tutorial for beginnersPHP tutorial for beginners Keywords: php tutorial for beginners; fsockopen tutorial; php fsockopen tutorial; oci connect; simple php mailing list; Paid traffic cost: N/A |
W3cyberlearnings.com:Keywords: php chop; php sqrt; php fputs; php popen; php stat; Paid traffic cost: N/A |
Forums.devshed.com: Dev Shed Forums - Open Source web developmentDev Shed Forums - over 275,577 members on our Dev Shed forums. Keywords: general merchandise retail; pc cillin; pc-cillin; php forum; cfm; Paid traffic cost: N/A |
Stackoverflow.com: Stack OverflowKeywords: orkut login; php; 0; localhost; gogole; Paid traffic cost: N/A |
Functions-online.com: execute PHP online - functions-onlineTest functions of the language PHP. You find functions in the categories array, cryptography, custom, date and time, general, math, regular expression, string and url. Keywords: strpos; str_replace; mktime; urldecode; online php; Paid traffic cost: N/A |
W3schools.com: W3Schools Online Web TutorialsHTML XHTML CSS JavaScript XML XSL ASP SQL ADO VBScript Tutorials References Examples Keywords: doctype; table; ol; background; html; Paid traffic cost: N/A |
Forum.sa-mp.com: SA-MP Forums - Powered by vBulletinMultiplayer gaming discussion surrounding GTA: San Andreas Keywords: sscanf; server advertising; fs download; server.exe; host my server; Paid traffic cost: N/A |
Kb.siteground.com: Web Hosting Knowledge Base by SiteGroundThe largest web hosting knowledge base. Answers on website down, email, FTP, Domain name, website tranfer, FrontPage, cPanel, Fantastico, billing, SiteBuilder, eCommerce, SSL, PHP and MySQL scripts problems and more. Keywords: smtp port; free smtp server; port 21; ftp port; web ftp; Paid traffic cost: N/A |
W3resource.com:Keywords: _server; sql count; sql union; sql group by; php date; Paid traffic cost: N/A |
Tutorialhero.com: Free tutorials - Photoshop tutorials - Flash tutorialsKeywords: catia tutorial; microstation tutorial; architectural desktop tutorial; vectorworks tutorial; turbocad tutorial; Paid traffic cost: N/A |
Lists.mysql.com: MySQL ListsKeywords: 40101; genteirc; myodbc; error code 126; select name; Paid traffic cost: N/A |
Other top sites:
Recently processed sites:
snowflakekitchen.wordpress.com
snowflakelightmachine.cheaplighting4u.com