Summary report for "njreefers.org" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Title: The New Jersey Reefers Club - Home

Description: New Jersey Reefers Club: A reefing community of people local to the New Jersey area. We are an active club with more than 300 reefers. We have relationships with many of the local fish stores resulting in discounts in the stores. We also have relationships with many on-line retailers of fish and corals who also provide discounts to club members. Our mission is to educate people on reef conservatio

Description: New Jersey Reefers Club: A reefing community of people local to the New Jersey area. We are an active club with more than 300 reefers. We have relationships with many of the local fish stores resulting in discounts in the stores. We also have relationships with many on-line retailers of fish and corals who also provide discounts to club members. Our mission is to educate people on reef conservatio

Advertising budget: N/A

This site in Alpha Directory: n nj njr


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 222.86 $111.19*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

Top cost equivalent positions (view all 64)   Top traffic positions (view all 64)   Top positions (view all 64)  
  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. reefers $79.26  10    1. reefers 86  10    1. eheim 2021   2   
2. orange shoulder tang $10.75  8    2. tropiquarium 37  9    2. luminarc mini   3   
3. tropiquarium $9.18  9    3. orange shoulder tang 26  8    3. anemone id   5   
4. eheim 2017 $6.71  7    4. eheim 2017 13  7    4. roes marine world   7   
5. fish store finder $1.06  12    5. aquatic obsessions 10    5. brian conger   7   
6. kati ani $0.62  19    6. manhattan reefs 17    6. eheim 2017   7   
7. ice cap 660 $0.41  18    7. eheim 2021 2    7. eggcrate styrene lighting   7   
8. aro ballast $0.39  19    8. kati ani 19    8. anemone id   8   
9. aquatic obsessions $0.31  10    9. nova extreme t 5 fixtures w lunar lights 8    9. typhoon skimmer   8   
10. manhattan reefs $0.29  17    10. reef encounter hackensack 9    10.      

Competitors for "njreefers.org"

Tampabay.citysearch.com: Tampa, FL Metro City Guide - Reviews and Recommendations by Citysearch

The Citysearch® Guide to Tampa, FL Metro. Tampa, FL Metro restaurants, bars, night clubs, hotels, shops, spas, events, attractions, yellow page listings and more. Find reviews, recommendations, directions and information on all the latest venues and businesses in Tampa, FL Metro.

Keywords: bell insurance; alicevip; lasik plus; bell auto insurance; cash register auto insurance;

Paid traffic cost: N/A

Reefs.com: Reefs.com | Your source for the latest reef news

The premier online destination for aquarium hobbyists and lovers of reef and marine life. Reefs.com features the best content from the most entertaining and intelligent experts in the world. Come check out our Blog, Forums, Wiki, Databases, Magazine and more, all for free!

Keywords: reefs; tube anemone; manhattan reefs; www reef com; snakefish;

Paid traffic cost: $1.62

Reefcentral.com: Reef Central Online Community

Reef Central is dedicated to the marine reef aquarium hobby. Learn about reef aquarium setup and maintenance, and view coral and marine fish photos. Visit our online community and ...

Keywords: reef; reef central; reefcentral; reef forum; reef aquarium;

Paid traffic cost: N/A

Blog.aquanerd.com: AquaNerd - Reef Aquarium and Saltwater Hobbyist Blog

At AquaNerd learn about coral reef, saltwater aquariums, aquarium fish, saltwater fish, corals, fish aquarium, marine aquarium, and reef aquarium.

Keywords: tenecor; tenecor aquariums; nano cube; fish gallery; radion;

Paid traffic cost: N/A

Forums.saltwaterfish.com: Saltwaterfish.com - Saltwater fish forums and reviews

Saltwaterfish.com: Saltwaterfish.com is the ultimate community for saltwater fish enthusiasts.

Keywords: saltwater fish forum; long distance walkie talkie; blue sponge; sharks for sale; cute signs;

Paid traffic cost: N/A

Fishedz.com: FisHedz.com - All About the Freshwater Aquarium Hobby

See freshwater, tropical fish videos and photos, play our aquarium game, and learn about what you’ll need to get started with the freshwater aquarium hobby.

Keywords: colorful aquarium fish; tropical fish coloring pages; fish store finder; aquarium fish photos; pet store finder;

Paid traffic cost: $0.14

Nano-reef.com: Nano-Reef.com - The source for nano reef aquarium information

Keywords: nanoreef; reef com; reef.com; nanocube; money cowrie;

Paid traffic cost: N/A

Coralvue.com: CoralVue Aquarium Lighting and Supplies

Provider of excellent Saltwater aquarium products including Super Reef Octopus, Aquarium Lighting, Protein Skimmers, Reeflux Metal Halide Bulbs, Lumen Bright Reflectors.

Keywords: coralvue; water blaster; reeflux; t5 led; waterblaster;

Paid traffic cost: N/A

Reefbuilders.com: Reef Builders | The Reef and Marine Aquarium Blog

Reef Builders | The Reef and Marine Aquarium Blog:

Keywords: tenecor; tenecor aquariums; reef central; zeolith; reef builder;

Paid traffic cost: N/A

Forum.marinedepot.com: Marine Depot Forums

Keywords: recirculating skimmer; marine forums; kati ani; multitank; coralife ballast;

Paid traffic cost: N/A

Marinedepot.com: Aquarium Pet Fish Supplies, Tank Accessories, Products & Equipment

Your #1 source for aquarium pet fish supplies, fish tank accessories, products and equipment. We offer guaranteed low prices and free shipping, visit us today!

Keywords: aquarium fish tank; t5; protein skimmer; fish supplies; aquarium lighting;

Paid traffic cost: $63.71K

Reefsanctuary.com: Reef Sanctuary

Saltwater Reef Aquarium advice, discussion, photos, equipment reviews in a friendly community atmosphere

Keywords: top fin; denitrator; cyano; best protein skimmer; top fin aquarium;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

leesfreakthemightyblog.blogspot.com

leesfurnishers.co.uk

leesfurniturefloorsandmore.com

leesgallery.blogspot.com

leesgarage.com

Recently processed sites:

wasteandrecyclingmarketplace.com

wasteandrecyclingnews.com

wasteandrecycling.rrc.qld.gov.au

wasteandresources.dk

wasteatlanta.com


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: