
Summary report for "lolroflmao.com" (monthly stats)
Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors
Advertising budget: N/A
This site in Alpha Directory: l lo lol
Approximate SE paid and organic traffic
| Traffic | Est. Cost | |
|---|---|---|
| Organic keywords | 9.87K | $2.42K* |
| Paid keywords | N/A | N/A |
Try our new SERPTrends addon
SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.
Learn more about SERP Trends addon »
Organic keywords
| Top cost equivalent positions (view all 318) | Top traffic positions (view all 318) | Top positions (view all 318) | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Keyword | Cost Equiv. | Position | Keyword | Traffic | Position | Keyword | Position | |||||||
| 1. | yarrak | $1.41K | 7 | 1. | yarrak | 5K | 7 | 1. | wormhole cat | 1 | ||||
| 2. | bass solo | $150.32 | 20 | 2. | 1 2 3 4 5 6 7 8 9 | 2K | 1 | 2. | lol roflmao | 1 | ||||
| 3. | big carrot | $108.38 | 5 | 3. | bass solo | 406 | 20 | 3. | wanna play no clothes required | 1 | ||||
| 4. | 1 2 3 4 5 6 7 8 9 | $76.14 | 1 | 4. | cocking fuckborough | 265 | 4 | 4. | storm trooper cars | 1 | ||||
| 5. | big carrot | $66.52 | 8 | 5. | see boobs | 175 | 4 | 5. | im in your face fast and furious | 1 | ||||
| 6. | real pacman | $62.23 | 15 | 6. | i love coloring | 160 | 10 | 6. | 1 2 3 4 5 6 7 8 9 | 1 | ||||
| 7. | rukia bleach | $47.65 | 14 | 7. | black monopoly | 131 | 10 | 7. | every night i go to sleep | 2 | ||||
| 8. | anne hat | $38.41 | 4 | 8. | big carrot | 117 | 5 | 8. | why so delicious | 2 | ||||
| 9. | 3 way chess | $33.37 | 9 | 9. | 1 2 3 4 5 6 7 8 | 96 | 6 | 9. | no clothes required | 2 | ||||
| 10. | penis face | $30.14 | 7 | 10. | big carrot | 72 | 8 | 10. | find the mistake | 2 | ||||
Competitors for "lolroflmao.com"
Finewoodworking.com: Fine Woodworking - videos, project plans, how-to articles, magazines, and booksExpert advice on woodworking and furniture making, with thousands of how-to videos, step-by-step articles, project plans, photo galleries, tool reviews, blogs, and more Keywords: woodworking; fine woodworking; fine woodworking magazine; finewoodworking; pie safe; Paid traffic cost: $2.73K |
Answers.yahoo.com: Yahoo! Answers - HomeYahoo! Answers is a new way to find and share information. You can ask questions on any topic, get answers from real people, and share your insights and experience. Keywords: o2; horse loan; yahoo answers; all categories; cheap; Paid traffic cost: N/A |
Imgur.com: imgur: the simple image sharerImgur is used to share photos with social networks and online communities. You can also view the funniest pictures from all over the Internet. There's no limit to how many you can share or upload, and uploading only takes seconds. Keywords: upskirt; downblouse; leaves; amazing photos; btjunkie; Paid traffic cost: N/A |
Onlineslangdictionary.com: The Online Slang Dictionary | WelcomeWelcome to The Online Slang Dictionary and Slang Thesaurus. Learn thousands of terms or add your own. Maps show you where slang is used. Keywords: bf; sol; player; skeezy; neden; Paid traffic cost: N/A |
Walyou.com: Gadgets Guide for New Gadgets, Cool Gadgets, Hi Tech News [Walyou]Latest Geek Guide for New Gadgets, Cool Gadgets, Hi Tech News, Geeky Designs, Spy Gadgets ,Future Concepts and a whole lot more fun Technology [Walyou] Keywords: pumpkin faces; real pacman; pumpkin face; cool keyboards; magnet furniture; Paid traffic cost: N/A |
Funnyjunk.com: Funnyjunk - Funny Pictures and Funny VideosFunny pictures, funny videos, flash games and funny movies Keywords: youtube.com; youtube videos; funny stuff; youtube com; funny; Paid traffic cost: N/A |
Neatorama.com: NeatoramaCartoonist Neill Cameron is spending a ... Previously on Neatorama: The Periodic Table of Awesoments ... Photo from BiographyAndBiographies. Dale Earnhardt ... Keywords: bugs bunny; urban legends; photographs; sponge bob; star trek voyager; Paid traffic cost: N/A |
Yarakgibiadam.tumblr.com:Keywords: yarrak; Paid traffic cost: N/A |
Fairuse.stanford.edu: Stanford Copyright & Fair Use CenterAFANA.com is the official site of the Australian Football Association of North America. We support the growth and promotion of Aussie Rules in North America. We supply info to learn about the sport, where to see or listen via TV, radio or internet. Keywords: copyright; 12345; fair use; public domain; use; Paid traffic cost: N/A |
Bleach.wikia.com: Bleach WikiBleach Wiki is a comprehensive guide to the manga and anime created by Tite Kubo. Keywords: bleach; ichigo; sonido; bleach rukia; bankai; Paid traffic cost: N/A |
Technabob.com: cool new gadgets, geek gifts, video games, gizmos and tech toys [technabob]find new gadgets, cool gadgets, geek gifts, video games, tech toys, computer mods, mobile technology, computers, home entertainment and high tech toys on technabob. Keywords: ifone; future technology; xphone; cool technology; chromatone; Paid traffic cost: N/A |
Other top sites:
Recently processed sites:
blackfridaydvdplayersales.blogspot.com
blackfridaydvdplayers.cheapprice47.com
blackfriday-dvi-lighting-bathroom.on2012deals.info
