Summary report for "fimeru.github.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Advertising budget: N/A

This site in Alpha Directory: f fi fim


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 30.57 $8.09*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

Top cost equivalent positions (view all 16)   Top traffic positions (view all 16)   Top positions (view all 16)  
  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. playmobil bank $6.15  16    1. australia facts for kids 14  14    1. kids line olivia crib bedding   6   
2. murder in the cathedral summary $0.72  15    2. playmobil bank 16    2. university of arkansas music camp   7   
3. australia facts for kids $0.70  14    3. murder in the cathedral summary 15    3. coleman tent trailer replacement canvas   8   
4. kids line olivia crib bedding $0.09  6    4. kids line olivia crib bedding 6    4. tuscaloosa county school calendar   10   
5. university of arkansas music camp $0.08  7    5. university of arkansas music camp 7    5. electrical control panel wiring   10   
6. electrical control panel wiring $0.07  10    6. electrical control panel wiring 10    6. celebrity victims of domestic violence   11   
7. tuscaloosa county school calendar $0.05  10    7. tuscaloosa county school calendar 10    7. heatilator fireplace manual   12   
8. coleman tent trailer replacement canvas $0.04  8    8. coleman tent trailer replacement canvas 8    8. tuscaloosa county schools calendar   13   
9. hdd smart reset $0.03  17    9. hdd smart reset 17    9. heatilator fireplace instructions   13   
10. heatilator fireplace instructions $0.03  13    10. heatilator fireplace instructions 13    10. cast of flavor of love   14   

Competitors for "fimeru.github.com"

Blog.arkansasalumni.org:

Keywords: tina fletcher; regina hopper; whitney green; matheney; hurley's saloon;

Paid traffic cost: N/A

Tentcole.com:

Keywords: coleman geosport shade; coleman tioga tent; coleman lighted sundome tent 12x10; coleman tents home page; coleman sundome tent 7x5;

Paid traffic cost: N/A

Epinions.com: Reviews from Epinions

Read Reviews on Digital Cameras, Cars, Books, Movies, Music and More.

Keywords: horchow; peltz famous brand shoes; hsn.com; hsn com; eloan;

Paid traffic cost: $5.01K

Fireside.com: Fireplace, Fireplaces from Fireside: Gas Fireplaces, Wood Fireplaces & Stoves!

Quality Gas + Wood Fireplaces, Gas Stoves, Wood Stoves, Fireplace Inserts for anywhere in your home. Hundreds of fireplaces to choose from.

Keywords: fireside; fireplace hearth; fire hearth; hearth and home; fireside hearth and home;

Paid traffic cost: $974.63

Lead-central.com:

Keywords: circuit breaker pdf; din rail pcb holder; electrical control panel wiring; mcb ratings; miniature breaker;

Paid traffic cost: N/A

Smartmontools.sourceforge.net: smartmontools Home Page (last updated $Date: 2008/07/25 10:43:23 $)

Public-domain Linux/Windows/Solaris/FreeBSD/NetBSD package contains two utility programs (smartctl and smartd) to control and monitor storage systems using ...

Keywords: badblocks; bad block; smartmontools; badblock; scsi devices;

Paid traffic cost: N/A

Idahocanvas.com: Idaho Canvas Products

Idaho Canvas Products has an impeccable 70 year reputation for fine quality canvas accessories specializing in stock and custom sewn wall tents, tepees, tarps, boat covers, industrial work gear, replacement covers for pop-up trailers, awnings for RV

Keywords: canvas banners; pop up camper canvas; reflective window shades; wall canvas; rv skirting;

Paid traffic cost: N/A

Downloads.eatoncanada.ca: Welcome to Electrical Group - Canada Download Area

Keywords: control panel design; electrical panel design; panel design; industrial control panel; 57600;

Paid traffic cost: N/A

Uacted.uark.edu: Welcome to the University of Arkansas Global Campus

The University of Arkansas Global Campus uses state-of-the-art technology that allows students located anywhere in Arkansas and around the globe to access courses taught by world-renowned University faculty members.

Keywords: anselm lambert; university of arkansas music camp; uark law; what does dissolute mean; university of arkansas global campus;

Paid traffic cost: N/A

Uafs.edu:

Keywords: arkansas fort smith; university of arkansas; fort smith; u of a fort smith; fort smith ar;

Paid traffic cost: $3.63K

Kids-world-travel-guide.com: Kids World Travel Guide: Online Travel Guide for Kids and Parents

Travelling with Kids always is exciting. With our Kids World Travel Guide you will see our beautiful world through childrens eyes.

Keywords: pacific ocean facts; south africa children; italy facts; famous italians; south african children;

Paid traffic cost: N/A

Kidskonnect.com: Welcome To Kidskonnect

KidsKonnect has kids homework and educational help - a safe Internet gateway for kids created & maintained by educators. KidsKonnect links to a variety of sites on different curriculums and interests.

Keywords: human body; biomes; the human body; figurative language; optical illusions for kids;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

daniellombardimusic.com

daniellonatoli.com

daniellong.com

daniellongo.com

daniellongo.tumblr.com

Recently processed sites:

northmississippichristianfamily.wordpress.com

northmississippidental.com

north-mississippi-emmaus-community-inc-kosciusko-ms.assistance-from-nonprofits.aidpage.com

northmississippigrapevine.com

northmississippihillcountrypicnic.bandcamp.com


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: