
Summary report for "fimeru.github.com" (monthly stats)
Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors
Advertising budget: N/A
This site in Alpha Directory: f fi fim
Approximate SE paid and organic traffic
| Traffic | Est. Cost | |
|---|---|---|
| Organic keywords | 30.57 | $8.09* |
| Paid keywords | N/A | N/A |
Try our new SERPTrends addon
SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.
Learn more about SERP Trends addon »
Organic keywords
| Top cost equivalent positions (view all 16) | Top traffic positions (view all 16) | Top positions (view all 16) | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Keyword | Cost Equiv. | Position | Keyword | Traffic | Position | Keyword | Position | |||||||
| 1. | playmobil bank | $6.15 | 16 | 1. | australia facts for kids | 14 | 14 | 1. | kids line olivia crib bedding | 6 | ||||
| 2. | murder in the cathedral summary | $0.72 | 15 | 2. | playmobil bank | 4 | 16 | 2. | university of arkansas music camp | 7 | ||||
| 3. | australia facts for kids | $0.70 | 14 | 3. | murder in the cathedral summary | 2 | 15 | 3. | coleman tent trailer replacement canvas | 8 | ||||
| 4. | kids line olivia crib bedding | $0.09 | 6 | 4. | kids line olivia crib bedding | 2 | 6 | 4. | tuscaloosa county school calendar | 10 | ||||
| 5. | university of arkansas music camp | $0.08 | 7 | 5. | university of arkansas music camp | 2 | 7 | 5. | electrical control panel wiring | 10 | ||||
| 6. | electrical control panel wiring | $0.07 | 10 | 6. | electrical control panel wiring | 1 | 10 | 6. | celebrity victims of domestic violence | 11 | ||||
| 7. | tuscaloosa county school calendar | $0.05 | 10 | 7. | tuscaloosa county school calendar | 1 | 10 | 7. | heatilator fireplace manual | 12 | ||||
| 8. | coleman tent trailer replacement canvas | $0.04 | 8 | 8. | coleman tent trailer replacement canvas | 1 | 8 | 8. | tuscaloosa county schools calendar | 13 | ||||
| 9. | hdd smart reset | $0.03 | 17 | 9. | hdd smart reset | 1 | 17 | 9. | heatilator fireplace instructions | 13 | ||||
| 10. | heatilator fireplace instructions | $0.03 | 13 | 10. | heatilator fireplace instructions | 1 | 13 | 10. | cast of flavor of love | 14 | ||||
Competitors for "fimeru.github.com"
Blog.arkansasalumni.org:Keywords: tina fletcher; regina hopper; whitney green; matheney; hurley's saloon; Paid traffic cost: N/A |
Tentcole.com:Keywords: coleman geosport shade; coleman tioga tent; coleman lighted sundome tent 12x10; coleman tents home page; coleman sundome tent 7x5; Paid traffic cost: N/A |
Epinions.com: Reviews from EpinionsRead Reviews on Digital Cameras, Cars, Books, Movies, Music and More. Keywords: horchow; peltz famous brand shoes; hsn.com; hsn com; eloan; Paid traffic cost: $5.01K |
Fireside.com: Fireplace, Fireplaces from Fireside: Gas Fireplaces, Wood Fireplaces & Stoves!Quality Gas + Wood Fireplaces, Gas Stoves, Wood Stoves, Fireplace Inserts for anywhere in your home. Hundreds of fireplaces to choose from. Keywords: fireside; fireplace hearth; fire hearth; hearth and home; fireside hearth and home; Paid traffic cost: $974.63 |
Lead-central.com:Keywords: circuit breaker pdf; din rail pcb holder; electrical control panel wiring; mcb ratings; miniature breaker; Paid traffic cost: N/A |
Smartmontools.sourceforge.net: smartmontools Home Page (last updated $Date: 2008/07/25 10:43:23 $)Public-domain Linux/Windows/Solaris/FreeBSD/NetBSD package contains two utility programs (smartctl and smartd) to control and monitor storage systems using ... Keywords: badblocks; bad block; smartmontools; badblock; scsi devices; Paid traffic cost: N/A |
Idahocanvas.com: Idaho Canvas ProductsIdaho Canvas Products has an impeccable 70 year reputation for fine quality canvas accessories specializing in stock and custom sewn wall tents, tepees, tarps, boat covers, industrial work gear, replacement covers for pop-up trailers, awnings for RV Keywords: canvas banners; pop up camper canvas; reflective window shades; wall canvas; rv skirting; Paid traffic cost: N/A |
Downloads.eatoncanada.ca: Welcome to Electrical Group - Canada Download AreaKeywords: control panel design; electrical panel design; panel design; industrial control panel; 57600; Paid traffic cost: N/A |
Uacted.uark.edu: Welcome to the University of Arkansas Global CampusThe University of Arkansas Global Campus uses state-of-the-art technology that allows students located anywhere in Arkansas and around the globe to access courses taught by world-renowned University faculty members. Keywords: anselm lambert; university of arkansas music camp; uark law; what does dissolute mean; university of arkansas global campus; Paid traffic cost: N/A |
Uafs.edu:Keywords: arkansas fort smith; university of arkansas; fort smith; u of a fort smith; fort smith ar; Paid traffic cost: $3.63K |
Kids-world-travel-guide.com: Kids World Travel Guide: Online Travel Guide for Kids and ParentsTravelling with Kids always is exciting. With our Kids World Travel Guide you will see our beautiful world through childrens eyes. Keywords: pacific ocean facts; south africa children; italy facts; famous italians; south african children; Paid traffic cost: N/A |
Kidskonnect.com: Welcome To KidskonnectKidsKonnect has kids homework and educational help - a safe Internet gateway for kids created & maintained by educators. KidsKonnect links to a variety of sites on different curriculums and interests. Keywords: human body; biomes; the human body; figurative language; optical illusions for kids; Paid traffic cost: N/A |
Other top sites:
Recently processed sites:
northmississippichristianfamily.wordpress.com
north-mississippi-emmaus-community-inc-kosciusko-ms.assistance-from-nonprofits.aidpage.com
