Summary report for "cypressnorth.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Advertising budget: N/A

This site in Alpha Directory: c cy cyp


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 451.9 $407.92*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

Top cost equivalent positions (view all 31)   Top traffic positions (view all 31)   Top positions (view all 31)  
  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. search marketing services $146.97  13    1. buffalo rising 182  7    1. plus pic   3   
2. buffalo rising $105.70  7    2. ajax error 34  7    2. ajax.request json   3   
3. voip network diagram $30.62  7    3. buffalorising 21  8    3. home office voip   4   
4. small office voip $19.57  12    4. voip network diagram 16  7    4. page size google   4   
5. office voip $18.54  19    5. your local business 16  6    5. setup voip at home   5   
6. small office voip $18.36  13    6. ajax.request json 14  3    6. jquery cross domain xml   5   
7. small office voip $16.99  14    7. twitter background size 14  19    7. stone art memorial   5   
8. choco logo $15.55  9    8. search marketing services 13  13    8. fun social websites   5   
9. north com $6.50  16    9. plus pic 3    9. twitter javascripts   5   
10. north marketing $6.13  11    10. choco logo 9    10. from your personal   6   

Competitors for "cypressnorth.com"

Seo.com: SEO.com | Search Engine Optimization SEO & Internet Marketing Company

Increase your bottom line with SEO.com: a search engine optimization and internet marketing company specializing in SEO and SEM services. Click to learn more!

Keywords: seo; search engine optimization company; search engine optimization services; search engine marketing service; search engine marketing company;

Paid traffic cost: $87.00K

Garynorth.com: Gary North -- Specific Answers

Gary North on current economic affairs and investment markets

Keywords: used washing machines; dave ramsey; gary north; get out of debt free; used washing machine;

Paid traffic cost: N/A

5northmarketing.com:

Keywords: north marketing; freelance copy writers; blog tweaks;

Paid traffic cost: N/A

Coms.com: Business Phone Systems: VOIP Providers | Hosted IP-PBX Solutions for SME and UK Phone Users - Coms

Home - Leading provider of Hosted VoIP business phone systems to UK SME, corporate and enterprise customers. Get free calls within your team, wherever they are. Get massively discounted call rates to any landline, home and abroad, with no capital outlay.

Keywords: coms; voip network diagram; business telephony; hosted pbx voip; gn9330;

Paid traffic cost: N/A

North.com: NORTH : a brand agency in portland oregon

NORTH | Brand advertising and content | design + film + interactive + music | Based in Portland

Keywords: north; www north com; www.north.com; north com; design agency north;

Paid traffic cost: N/A

Truenorthmarketingservices.com: True North Marketing Services - Home Page

True North Marketing Services specializes in e-Mail marketing, web strategy, CRM data mining and social media for start-ups to medium-sized companies in the Philadelphia area. True North provides companies with marketing services on an outsourced basis and is located in Pottstown, PA.

Keywords: north marketing; true north marketing;

Paid traffic cost: N/A

Mdsgateways.com: MDS Gateways Homepage

MDS Gateways website

Keywords: voip network diagram; voip setup diagram; voip setup guide; voip network diagrams; auto attendant messages;

Paid traffic cost: N/A

Kaanengroup.com:

Keywords: search marketing services; ppc manager; pay per click manager; ppc management service; ppc management firm;

Paid traffic cost: N/A

Buffalorising.com: Buffalo Rising | Your Guide to Buffalo NY News, Arts, Events & Buffalo Restaurants

Buffalo Rising Online: our beat is New Buffalo and we cover it with original content written by fellow Buffalonians knowledgeable and passionate about their city.

Keywords: rick martin; buffalo rising; bethlehem steel; save a lot; gelateria;

Paid traffic cost: N/A

Northcom.mil:

Keywords: norad; northcom; peterson afb; north com; peterson afb map;

Paid traffic cost: N/A

Tenthavenuenorth.com: Tenth Avenue North: Home

Keywords: north video; tenth; avenue north; 10th avenue north; ave north;

Paid traffic cost: $11.71

Marketingnorthamerica.com: Marketing North America

MarketingNorthAmerica.com is a directory listing advertising agencies, job opportunities, trade shows and brand strategy specialists.

Keywords: north america marketing; north marketing; north america market; adweek directory;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

ntpwa.org

ntpwarranty.com

ntpwind.com

ntpwireless.com

ntpwomen.org

Recently processed sites:

cheapsilverflatwarechest3820.3owl.com

cheapsilverjewelry40.wikispaces.com

cheapsim.co.uk

cheapsimplicitysewingmachinesreviews.blogspot.com

cheapsinglebeds.net


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: