Summary report for "arrayseq.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Advertising budget: N/A

This site in Alpha Directory: a ar arr


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 8.63 $0.43*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

Top cost equivalent positions (view all 15)   Top traffic positions (view all 15)   Top positions (view all 15)  
  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. alternative isoform regulation in human tissue transcriptomes $0.15  6    1. alternative isoform regulation in human tissue transcriptomes 6    1. alternative isoform regulation in human tissue transcriptomes   6   
2. illumina 550k $0.07  8    2. illumina 550k 8    2. illumina 550k   8   
3. rat pbmc $0.07  8    3. rat pbmc 8    3. genome scale dna methylation maps of pluripotent and differentiated cells   8   
4. genome scale dna methylation maps of pluripotent and differentiated cells $0.05  8    4. genome scale dna methylation maps of pluripotent and differentiated cells 8    4. rat pbmc   8   
5. atcc 25923 $0.02  15    5. atcc 25923 15    5. agilent 244k   13   
6. agilent 244k $0.02  13    6. agilent 244k 13    6. paired end ditag   14   
7. k14 cre $0.01  15    7. k14 cre 15    7. k14 cre   15   
8. paired end ditag $0.01  14    8. paired end ditag 14    8. atcc 25923   15   
9. locusta migratoria manilensis $0.01  19    9. locusta migratoria manilensis 19    9. cd11c cre   16   
10. cd11c cre $0.01  16    10. cd11c cre 16    10. vastus lateralis muscle biopsy   17   

Competitors for "arrayseq.com"

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

coastalmax.com

coastalmc.com

coastal-mechanical.com

coastalmechanical.com

coastalmechanicalcontractors.net

Recently processed sites:

deerparkcountryclub.com

deerparkcountryhotel.co.uk

deerparkcriminaldefenselawyer.com

deerparkculture.blogspot.com

deerparkdeli.com


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: